PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004496628.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 253aa    MW: 29094.8 Da    PI: 7.9421
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004496628.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF901.2e-28959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    +ri+nk+nrqvtfskRr g+lKKA+ELSvLCdaeva+iifss gkl+ ys+
  XP_004496628.1  9 ERIQNKINRQVTFSKRRSGLLKKAFELSVLCDAEVALIIFSSLGKLFQYST 59
                    69***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.838161IPR002100Transcription factor, MADS-box
SMARTSM004324.6E-37160IPR002100Transcription factor, MADS-box
CDDcd002652.34E-38272No hitNo description
SuperFamilySSF554551.44E-30275IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-29323IPR002100Transcription factor, MADS-box
PfamPF003193.0E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-293859IPR002100Transcription factor, MADS-box
PfamPF014861.7E-1685171IPR002487Transcription factor, K-box
PROSITE profilePS5129712.06888185IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MGRGKVVLER IQNKINRQVT FSKRRSGLLK KAFELSVLCD AEVALIIFSS LGKLFQYSTT  60
DLNKIIEKYR QCCFDNMSEN GDLGEHQSQS LYQELLMLRV KHESLAQTQR NFLGEELHAL  120
SMKDLQSLEK QLERTLAQAR KQQVQKLMAR VDELRNEVHK GEEVTKQLKS KEIGISTKFC  180
EDSTNSNISI NNHIITSLHD AQADPFEHGT TGHFDCSRFG HQEAAASEEQ ATDRRMNRGQ  240
SSRNKNNEYE WMN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A4e-24269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B4e-24269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C4e-24269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D4e-24269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P5e-24169169Myocyte-specific enhancer factor 2B
1tqe_Q5e-24169169Myocyte-specific enhancer factor 2B
1tqe_R5e-24169169Myocyte-specific enhancer factor 2B
1tqe_S5e-24169169Myocyte-specific enhancer factor 2B
3kov_A4e-24269168Myocyte-specific enhancer factor 2A
3kov_B4e-24269168Myocyte-specific enhancer factor 2A
3kov_I4e-24269168Myocyte-specific enhancer factor 2A
3kov_J4e-24269168Myocyte-specific enhancer factor 2A
3p57_A4e-24269168Myocyte-specific enhancer factor 2A
3p57_B4e-24269168Myocyte-specific enhancer factor 2A
3p57_C4e-24269168Myocyte-specific enhancer factor 2A
3p57_D4e-24269168Myocyte-specific enhancer factor 2A
3p57_I4e-24269168Myocyte-specific enhancer factor 2A
3p57_J4e-24269168Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004496628.10.0PREDICTED: MADS-box transcription factor 17-like isoform X1
SwissprotQ7XUN23e-62MAD17_ORYSJ; MADS-box transcription factor 17
TrEMBLQ56NI61e-134Q56NI6_PEA; MADS box protein M3
STRINGGLYMA20G29250.14e-97(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132231730
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.12e-53AGAMOUS-like 6